Log In | Shopping Cart | Advanced Search
            
  • Home
  • Career
  • Distributors
  • Contact Us:
  • Email: crm@excellgen.com
Products
Modified mRNA
Encapsulated mRNA
mRNA Enzyme
SARS-CoV-2
Pseudovirus
Popular Products
Cancer Proteins
Antibodies
DNA Binding Proteins
Electrophoresis
Genome Engineering
Polymerases
Recombinases
Transcription Factors
Transfection
Services
Modified mRNA
Custom Cloning
Virus Production
Protein Purification
Protein Expression
DNA Modifying Enzymes
 Previous 
 Return to List 
 Next 

Thermus aquaticus Muts DNA mismatch repair protein, 6X His-Taq-Muts

Catalog #: EG-41


Please Choose:



Qty:

Product Name Thermus aquaticus MutS DNA mismatch repair protein, 6XHis-Taq-Muts
Size 100 µg
Description

The Taq MutS DNA mismatch protein recognizes heteroduplex DNAs containing mispaired or unpaired bases. This Muts protein binds in vitro to heteroduplex DNAs containing mispaired or unpaired bases over a wide temperature range from 4 to 70 °C and has a thermostable ATPase activity. This thermostable Taq MutS is active at temperature between 0 to 75°C. Since Taq MutS efficiently binds to 1-4 bases deletion (or insertion) and mismatch base pairs of GT, CT and AG, it is useful for detecting these mutations. Mutations can be detected in polyacrylamide gels or on a solid phase such as Ni agarose or beads or magnetic Ni-NTA particles.

Applications
  • Remove mismatch DNA (error correction) from gene synthesis reaction
  • Mutation detection and removal
  • Rapid isothermal SNP detection
Source E. coli
Fusion Tag 6XHis tag at C-terminus
Purification Method FPLC
Purity

~ 95% as determined by SDS-PAGE

Accession # AAC43637, TAU3311, U33117
Gene Name Thermus aquaticus MutS DNA mismatch repair protein
MW 92.8 kDa
Protein Sequence

MKIEHMEGMLKGEGPGPLPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALG
LVLTHKTSKDFTTPMAGIPLRAFEAYAERLLKMGFRLAVADQVEPAEEAEGLVRREVTQL
LTPGTLLQESLLPREANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKSALYDELFRHRP
AEVLLAPELLENGAFLDEFRKRFPVMLSEAPFEPEGEGPLALRRARGALLAYAQRTQGGA
LSLQPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLFSVLDETRTAPGRRLLQSWLRHP
LLDRGPLEARLDRVEGFVREGALREGVRRLLYRLADLERLATRLELGRASPKDLGALRRS
LQILPELRALLGEEVGLPDLSPLKEELEAALVEDPPLKVSEGGLIREGYDPDLDALRAAH
REGVAYFLELEERERERTGIPTLKVGYNAVFGYYLEVTRPYYERVPKEYRPVQTLKDRQR
YTLPEMKEKEREVYRLEALIRRREEEVFLEVRERAKRQAEALREAARILAELDVYAALAE
VAVRYGYVRPRFGDRLQIRAGRHPVVERRTEFVPNDLEMAHELVLITGPNMAGKSTFLRQ
TALIALLAQVGSFVPAEEAHLPLFDGIYTRIGASDDLAGGKSTFMVEMEEVALILKEATE
NSLVLLDEVGRGTSSLDGVAIATAVAEALHERRAYTLFATHYFELTALGLPRLKNLHVAA
REEAGGLVFYHQVLPGPASKSYGVEVAAMAGLPKEVVARARALLQAMAARREGALDAVLE
RLLALDPDRLTPLEALRLLQELKALALGAPLDTMKGKLAAALEHHHHHH

Storage Buffer 20 mM Tris-HCl, pH 8.0, 250 mM NaCl, 0.1mM EDTA, 1 mM DTT, 50% Glycerol
Reaction Buffer 100mM KCl, 50 mM Tris-HCl, pH 8.5, 5~20 mM MgCl2, 0.1 mM EDTA, 1 mM DTT, 2% Glycerol, 65 °C
Storage -20 to -80 °C.
Shipping 4°C or dry ice

Protocol

(example)

1. After first round PCR, purify PCR fragments using Qiagen QIAquick PCR purification kit with elution in dH2O.

2. Dilute PCR product to 250 ng/µl in 10 mM Tris–HCl, pH 7.8, 50 mM NaCl and heat to 95 oC for 5 min followed by cooling at 0.1oC/s to 25 oC.

3. Add binding buffer (20 mM Tris–HCl, pH 7.8, 10 mM NaCl, 5 mM MgCl2, 1 mM DTT and 5% glycerol) to annealed PCR product, adjust DNA concentration to 11.5 ng/µl, add 6XHis-MutS dimers to 950 nM.

4. Incubate the mixture at room temperature for 10 min, then add an equal volume of Ni-NTA beads preequilibrated with 1X binding buffer, and incubate for 30 min at room temperature.

5. Gently spin down beads and save supernatant for subsequent processing (second round PCR, cloning etc).

References

1. Protein-mediated error correction for de novo DNA synthesis. Nucleic Acids Res. 2004 Nov 23;32(20):e162.

2. Correcting errors in synthetic DNA through consensus shuffling. Nucleic Acids Res. 2005 Mar 30;33(6):e55.

3. MutS as a tool for mutation detection. Acta Biochim Pol. 2005;52(3):575-83. Epub 2005 Aug 4.

4. One tube mutation detection using sensitive fluorescent dyeing of MutS protected DNA. Nucleic Acids Res. 2000 Apr 15;28(8):E36.

5. Rapid SNP diagnostics using asymmetric isothermal amplification and a new mismatch-suppression technology. Nature Methods - 4, 257 - 262 (2007) doi:10.1038/nmeth1007


Customers who bought this product also purchased...

Cre Recombinase, TAT-Cre (Tat-NLS-Cre, HTNC, HTNCre)
Cre Recombinase, TAT-Cre (Tat-NLS-Cre, HTNC, HTNCre)
Thermus aquaticus Muts DNA mismatch repair protein, C-6X His-MBP-Taq-Muts
Thermus aquaticus Muts DNA mismatch repair protein, C-6X His-MBP-Taq-Muts
Thermus aquaticus Muts DNA mismatch repair protein, N-6X His-MBP-Taq-Muts
Thermus aquaticus Muts DNA mismatch repair protein, N-6X His-MBP-Taq-Muts
E. coli RecA
E. coli RecA
Thermus thermophilus Muts DNA mismatch repair protein
Thermus thermophilus Muts DNA mismatch repair protein
     
 Ask a Question 
 
 Home | Privacy Policy | Terms & Conditions | Online Price Policy | Shipping & Return

Copyright © 2007-2022  Excellgen, Inc. All rights reserved